Protein Info for GFF4869 in Sphingobium sp. HT1-2

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 11 to 203 (193 residues), 194.9 bits, see alignment E=2.5e-61 PF08659: KR" amino acids 13 to 164 (152 residues), 62.1 bits, see alignment E=1.7e-20 PF01370: Epimerase" amino acids 13 to 132 (120 residues), 24.6 bits, see alignment E=4e-09 PF13460: NAD_binding_10" amino acids 17 to 194 (178 residues), 32.4 bits, see alignment E=2.2e-11 PF13561: adh_short_C2" amino acids 17 to 249 (233 residues), 193.4 bits, see alignment E=1.2e-60

Best Hits

KEGG orthology group: None (inferred from 56% identity to mrd:Mrad2831_0062)

MetaCyc: 52% identical to 4-oxopentanoyl-CoA 4-dehydrogenase (Pseudomonas putida KT2440)
1.1.1.M44 [EC: 1.1.1.M44]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.M44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF4869 Oxidoreductase, short-chain dehydrogenase/reductase family (Sphingobium sp. HT1-2)
VNPDLFSLSGRVALVTGASSGIGRVLAQGLAAAGAHVVAVARRAERLDDLVREIEQSGGS
AVAAQADVTDVESIERAFDAAEQAFGTVDVIVSNAGVTDARNFLKIDPAARDAVFDTNLR
GVWNVGQAAARRLVSAGKGGSIINVASVLGLGVQPGLASYCASKGAVIQLTRAMAVDLTK
YNIRVNALAPGWFKTELNEAFFESTAGVERIAQMPARRLGRIEELMGPVIMLASDAGSFM
NGSVVVVDGALNALVA