Protein Info for PS417_02480 in Pseudomonas simiae WCS417

Annotation: DNA mismatch repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 TIGR00585: DNA mismatch repair protein MutL" amino acids 11 to 319 (309 residues), 337.1 bits, see alignment E=7e-105 PF02518: HATPase_c" amino acids 30 to 86 (57 residues), 30.7 bits, see alignment 7.6e-11 PF13589: HATPase_c_3" amino acids 33 to 134 (102 residues), 48.3 bits, see alignment E=2.2e-16 PF01119: DNA_mis_repair" amino acids 222 to 338 (117 residues), 138 bits, see alignment E=2.4e-44 PF08676: MutL_C" amino acids 452 to 594 (143 residues), 164.7 bits, see alignment E=2.3e-52

Best Hits

Swiss-Prot: 98% identical to MUTL_PSEFS: DNA mismatch repair protein MutL (mutL) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 98% identity to pfs:PFLU0518)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TUX2 at UniProt or InterPro

Protein Sequence (638 amino acids)

>PS417_02480 DNA mismatch repair protein (Pseudomonas simiae WCS417)
MSESILDNGSRIELLSPRLANQIAAGEVVERPASVIKELLENSIDSGAKRIDVDVEQGGV
KLLRVRDDGSGISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLT
SRTRSAEQAWQVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHL
QEVIKRLALARFDVAFHLRHNGKTILSLHEAHDDAARARRVSAICGPGFLEQALPIEIER
NGLRLWGWVGLPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFF
EVDPSVVDVNVHPTKHEVRFRDGRMVHDFLYGTLHRTLGDVRPDDQLAAPIVTAVVRPSG
PQAGEFGPQGEMSLAANLLQSPQSQPSYTAPNAGAGSGYQYQYTPRPQSAVPVAEAQAAY
REFFAPLPGAEPGAPVALPEGGGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERI
MYERLKIAMASEGLSGQPLLVPESLAVSQREADCAEEHHSVFQKLGFELQRLGPETLAIR
QIPALLKQAEANRLVADVLADLMEYGTSDRIQAHINELLGTMACHGAIRANRRLALPEMN
GLLRDMENTERSGQCNHGRPTWTQMGLDDLDKLFLRGR