Protein Info for GFF486 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable Co/Zn/Cd efflux system membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 364 (328 residues), 260.1 bits, see alignment E=1.2e-81 PF25917: BSH_RND" amino acids 61 to 202 (142 residues), 75.7 bits, see alignment E=8.5e-25 PF25876: HH_MFP_RND" amino acids 102 to 171 (70 residues), 52.1 bits, see alignment E=2.6e-17 PF25944: Beta-barrel_RND" amino acids 208 to 290 (83 residues), 79.8 bits, see alignment E=6.5e-26 PF25954: Beta-barrel_RND_2" amino acids 211 to 289 (79 residues), 25.2 bits, see alignment E=6.3e-09 PF25989: YknX_C" amino acids 296 to 364 (69 residues), 53.9 bits, see alignment E=5.4e-18 PF25967: RND-MFP_C" amino acids 296 to 355 (60 residues), 42.5 bits, see alignment E=2e-14 PF25975: CzcB_C" amino acids 297 to 351 (55 residues), 27.6 bits, see alignment 8.9e-10

Best Hits

Swiss-Prot: 48% identical to MDTA_CROTZ: Multidrug resistance protein MdtA (mdtA) from Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 54% identity to cja:CJA_0373)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF486 Probable Co/Zn/Cd efflux system membrane fusion protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LWLGLFLGVGFAAWWFLLRPPPQPPAAPSAWRGPVAVRVEPARTEDFTVQARAVGTVAPY
NTVTVRSRVDGQLARVLVREGQKVARGQLLAEIDPEPLRVALAQAQGQQQQNLAQLRNAE
SELARYELLFKRDAVARQVLDRQAALVQQLRGTLKSDEAQVDNAKLQLSYTRIVAPIAGR
IGLRRVDAGNLLSANDANGLFTLTQTQPVSVVFNVPEPQVAEVRAAHDGKQPPQAEAWDR
DNRSRLAQGRLDTLDNQIDAATGTLRLKARFENADDALFPNQFVNVRLALRQLPGAVTIP
TDAVQHGSRGTYVYVVADNKAQVRDLTLGPASGGRTVVLKGLVSGEPVVLEGLDRLENGR
AVNVVQAAELPASSPLAPDAAPAAATAR