Protein Info for GFF4859 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 436 (434 residues), 557.2 bits, see alignment E=4.2e-171 TIGR00231: small GTP-binding protein domain" amino acids 4 to 124 (121 residues), 62.1 bits, see alignment E=8e-21 amino acids 181 to 339 (159 residues), 88.7 bits, see alignment E=5.4e-29 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 100.6 bits, see alignment E=2.5e-32 amino acids 183 to 300 (118 residues), 88.7 bits, see alignment E=1.2e-28 PF02421: FeoB_N" amino acids 5 to 155 (151 residues), 47.5 bits, see alignment E=5.9e-16 amino acids 182 to 320 (139 residues), 43.8 bits, see alignment E=8.2e-15 PF00009: GTP_EFTU" amino acids 71 to 164 (94 residues), 27.4 bits, see alignment E=9.7e-10 amino acids 214 to 347 (134 residues), 32 bits, see alignment E=3.6e-11 PF14714: KH_dom-like" amino acids 356 to 436 (81 residues), 88.4 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 83% identical to DER_ACIAC: GTPase Der (der) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03977, GTP-binding protein (inferred from 83% identity to aav:Aave_1428)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF4859 GTP-binding protein EngA (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKPVIALVGRPNVGKSTLFNRLTSSRDAIVADFAGLTRDRHYGNGRQGRREYIVIDTGGF
EPEASEGIYKEMAKQTRQAVAESDVVIFVVDARAGISAQDHEIAGYLRRLGKPTLLVANK
SEGMTQGLQLVEFYELGLGEVMAVSGAHGQGVRSMLDTALELIPGLPPEDEEEPEVETGV
IRLAVAGRPNVGKSTLINAWLGEERLVAFDLPGTTRDAISVPFERSGQKFELIDTAGIRR
KGRVFEAIEKFSVVKTLQAIENAHVVLLLLDATQGVTDQDAHIAGYILESGRAVVLAINK
WDAVDAYQREQIERQVETRLAFLKFASLHLISAQKRQGLGPVWKSITQAHASAMRKMSTP
VLTRLLMEAVAFQAPTRSGMFRPKMRYAHQGGMNPPVIVIHGNSLENVPDAYKRFLEGRF
RKAFDLVGTPLRIEFKTSANPFKE