Protein Info for GFF4856 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: HflK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 93 to 115 (23 residues), see Phobius details PF12221: HflK_N" amino acids 15 to 67 (53 residues), 24.4 bits, see alignment 2.2e-09 TIGR01933: HflK protein" amino acids 112 to 387 (276 residues), 297.2 bits, see alignment E=5.2e-93 PF01145: Band_7" amino acids 113 to 302 (190 residues), 95.7 bits, see alignment E=3.4e-31

Best Hits

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 75% identity to rfr:Rfer_2300)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF4856 HflK protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFNLNDPRWGRGDDEPRNDGGQDPGRDDDRNAQRPPPRGQGPNQGPPDLDELWRDFNRKL
GGLLGNKGRGGGHGGGNGSGGGAGFNPNPKATGIGFGLIAGVALLIWMGTGFFIVQEGQQ
AVITQFGKYHSSVGAGFNWRLPYPIQRHETVFVTQIRSVDVGRDNVVPATGLRESAMLTE
DENIVEIKFAVQYRLNDARAFLFESRDPDAAVVKVAETAVREVVGKMKMDAALAEERDQI
APRVRTLMQNILDRYKVGIEVVGINLQQGGVRPPEQVQASFDDVLKAGQERERAKNEAQA
YANDVVPRARGAASRLTEEAEGYRARIVAQAEGDSQRFRSVLAEYQKAPQVTRERMYTDA
MQEIYSNVTKVLVDSKSGSNLLYLPLDKIMQMTGQPASTPSVQPSAPTPSTIPAPTSRST
DNAARSRERESR