Protein Info for GFF4848 in Variovorax sp. SCN45

Annotation: Conjugative transfer protein TrbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 signal peptide" amino acids 1 to 52 (52 residues), see Phobius details transmembrane" amino acids 73 to 92 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details PF04956: TrbC" amino acids 32 to 120 (89 residues), 89.4 bits, see alignment E=7.4e-30

Best Hits

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 100% identity to rpi:Rpic_2646)

Predicted SEED Role

"Conjugative transfer protein TrbC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>GFF4848 Conjugative transfer protein TrbC (Variovorax sp. SCN45)
MTQMIVPAFRISANPLALRCRPARLDGLARPALQGLMLAALMLLLAGTAQAAGSSMPWEG
PLQSILESIQGPVARIIAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLS
FFSFSGGAVV