Protein Info for PS417_24790 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 69 to 90 (22 residues), see Phobius details PF07119: DUF1375" amino acids 30 to 79 (50 residues), 61.3 bits, see alignment E=4.3e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU5437)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4A0 at UniProt or InterPro

Protein Sequence (94 amino acids)

>PS417_24790 hypothetical protein (Pseudomonas simiae WCS417)
MSKALLILLALQLAGCATARALDAAKPGAPVVYAGTRLDLYAMKGGCCAKDRFGAEAPSY
PGVDLPASALLDTLLLPLSVLTVLGVGFNATGGL