Protein Info for GFF4846 in Xanthobacter sp. DMC5

Annotation: Nitrogenase molybdenum-iron protein beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR01285: nitrogenase molybdenum-iron cofactor biosynthesis protein NifN" amino acids 3 to 430 (428 residues), 597.4 bits, see alignment E=8.4e-184 PF00148: Oxidored_nitro" amino acids 19 to 430 (412 residues), 416.8 bits, see alignment E=4.3e-129

Best Hits

Swiss-Prot: 73% identical to NIFN_BRADU: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifN (nifN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02592, nitrogenase molybdenum-iron protein NifN (inferred from 88% identity to xau:Xaut_0092)

MetaCyc: 44% identical to Nitrogenase iron-molybdenum cofactor biosynthesis protein NifN (Azotobacter vinelandii)
RXN-17026

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifN" in subsystem Nitrogen fixation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>GFF4846 Nitrogenase molybdenum-iron protein beta chain (Xanthobacter sp. DMC5)
MAKFVQAKKSCAVNPLKMSQPIGGALAFMGLRGAMPLLHGSQGCTSFGLVLFVRHFKEAI
PLQTTAMSEVATVLGGYDNVEQAILNIYNRTKPEIIGICSTGVTETKGDDVDGYIKLIRE
KYPQLADFPLVYVSTPDFKDAFQDGWEKTVAKIVEVLVKKPEPDAPKNPKRVNVLPGCHL
QPGDLDELRCILEDFGLEPSFLPDLAGSLDGHIPDDFTPTTIGGIGVDEVATMGEAAWTI
AIGSQMKTAAEAMQKKTGTPYRLFERLCGLGPNDEFFMFLSEISGREVPRRYRRQRGQLV
DAMLDAHFHLGGRKLAIGAEPDLLFDVASALHEMGTHITAAVTTTQSPVFEKLPCDEVLL
GDLEDLETLAKERGCDLLLTHSHGRQAADRLNIPFYRIGIPMFDRIGSGHKMTVGYRGTR
DLMFTLANMCIADHEQNHDATPDTWKNPWDGDGHGHGATHVATPAGAPDLGPAPSTAHH