Protein Info for GFF4840 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LrgA-associated membrane protein LrgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details PF04172: LrgB" amino acids 10 to 223 (214 residues), 200.1 bits, see alignment E=1.6e-63

Best Hits

Swiss-Prot: 35% identical to YXAC_BACSU: Uncharacterized protein YxaC (yxaC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 56% identity to dia:Dtpsy_2405)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF4840 LrgA-associated membrane protein LrgB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAAAWTLVTLAAYAAALGLYRRSGHHLLCLPVLTGTALVLGALALAGTGYPVYAEATRL
LRWLTGPAIIALAVPLYRQAALLRRLALPLLGALLAGCLASVLGTLLLAWGLGSPLPFAL
SIAPKAATMPIAMQAVERAGGLPAVAALAVVATGVLGTLLAGPVLRLLRLDDATTRSFAL
GLVAHAIGTARALQTHPGSVAFAALAMGLNGVCTALVIALLARWL