Protein Info for GFF484 in Methylophilus sp. DMC18

Annotation: Aconitate hydratase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00117: aconitate hydratase 2
  • amino acids 1 to 843 (843 residues), 1497.2 bits, E=0
• PF11791: Aconitase_B_N
  • amino acids 4 to 155 (152 residues), 208.7 bits, E=6.6e-66
• PF06434: Aconitase_2_N
  • amino acids 167 to 370 (204 residues), 333.9 bits, E=5.6e-104
• PF00330: Aconitase
  • amino acids 463 to 805 (343 residues), 123.6 bits, E=1.7e-39

Best Hits

Swiss-Prot: 66% identical to ACNB_SYNY3: Aconitate hydratase B (acnB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01682, aconitate hydratase 2 [EC: 4.2.1.3] (inferred from 69% identity to aha:AHA_3856)

MetaCyc: 62% identical to aconitase (Helicobacter pylori 26695)
Aconitate hydratase. [EC: 4.2.1.3]

Predicted SEED Role

"Aconitate hydratase 2 (EC 4.2.1.3)" in subsystem Propionate-CoA to Succinate Module or TCA Cycle (EC 4.2.1.3)

MetaCyc Pathways

• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle V (2-oxoglutarate synthase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• TCA cycle III (animals) (6/10 steps found)
• glyoxylate cycle (3/6 steps found)
• TCA cycle II (plants and fungi) (5/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (5/9 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (17/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)
• reductive TCA cycle I (6/11 steps found)
• mixed acid fermentation (8/16 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (4/14 steps found)
• methylaspartate cycle (7/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.3

Protein Sequence (859 amino acids)

>GFF484 Aconitate hydratase B (Methylophilus sp. DMC18)
MLEAYDTHVKERAAQNLPPLPLNAEQVAALVELLKSPPAGQEALLVHLLENRIPAGVDQA
AYVKAAFLADIANGKASSPLVSAEKAVELLGTMLGGYNVQALVALLDTPMAAHAVKALST
TILMFDAFHDVDAKMKAGNTHAKTLMQAWAEAQWFTSKPALKDEIKVVVFKLDGETNTDD
LSPAQDAWSRPDIPLHAKAMLVNRMSDGLKVIEDLKQKGLPLAYVGDVVGTGSSRKSAIN
SVQWWMGDDIPFIPNKRTGGVVIGSKIAPIFFNTAEDSGALPIQCDVSKLNTGDVIVIKP
FEGKVLSEAGEVLATFEMNPVTLADEVRAGGRIPLIIGRGLTSNARKALGLGETDLFIKA
VPAKDTGKGYTLAQKMVGRACGLPEGMGVRPGTYCEPKATTVGSQDTTGGMTRDELKELA
CLGFSADLVMQSFCHTAAYPKPVDIKLQHELPEFMSSRGGVSLRAGDGVIHSWLNRMILP
DTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGAMPLDMPESVLVRFKGEMQPGITLRDL
VNAIPYAAIQEGTLTVGKQGKKNVFNGRVLEIEGLPDLKVEQAFELADASAERSANGCTV
LLNKEPVIEFLNSNIVLMQNMIENGYADARTLERRIASMKAWLEKPELLQPDSDAEYAHV
IEIDLNEIKEPLVACPNDPDDIKPLSAVVGDKIDEVFIGSCMTNIGHYRAAGKVLEGAGG
IPTRLWIAPPTRMDEAQLRAEGVYSTFGVAGARTEVPGCSLCMGNQARVADKATVFSTST
RNFDNRMGKDARVYLGSAELAAVCAKLGRMPTMQEYMDTLGSKLTNTAEIYKYLNFNQMT
QYAASLENSKKIIPIKETA