Protein Info for PS417_24745 in Pseudomonas simiae WCS417

Annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00171: Aldedh" amino acids 14 to 282 (269 residues), 53.1 bits, see alignment E=1e-18 amino acids 314 to 377 (64 residues), 25.7 bits, see alignment E=2.1e-10 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 16 to 410 (395 residues), 508.6 bits, see alignment E=5.4e-157

Best Hits

Swiss-Prot: 99% identical to PROA_PSEFS: Gamma-glutamyl phosphate reductase (proA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 99% identity to pfs:PFLU5427)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCM2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>PS417_24745 gamma-glutamyl phosphate reductase (Pseudomonas simiae WCS417)
MTESVLDYMTRLGRAARQASRLIARASTAQKNRALLAAADALDASRSELTAANEQDLANG
RANGLEPALLDRLALTPARIDDMIEGLRQVAKLPDPIGEIRDMRYLPSGIQVGKMRVPLG
VIGIIYESRPNVTIDAASLCLKSGNATILRGGSEAINSNRAIAACIQQGLAVAELPAEVV
QVVETTDRAAVGALITMPEFVDVIVPRGGKSLIERVSRDAKVPVIKHLDGVCHVYIDIAA
DIDKAIRIADNAKTHRYAPCNTMETLLVHVGIADRVLPPLAAIYRDKGVELRGCGRTRAL
LGADVIDATELDWYTEYTAPILSIKIVDDLDEAIEHINTYGSKHTDAIVSEHFSDARRFL
TEVDSASVMINASTRFADGFEYGLGAEIGISTDKLHARGPVGLEGLTSEKYVVFGDGHVR
T