Protein Info for GFF4836 in Variovorax sp. SCN45

Annotation: Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF02912: Phe_tRNA-synt_N" amino acids 20 to 87 (68 residues), 72.1 bits, see alignment E=3e-24 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 38 to 357 (320 residues), 304.6 bits, see alignment E=4.3e-95 PF01409: tRNA-synt_2d" amino acids 92 to 357 (266 residues), 278.9 bits, see alignment E=3.8e-87

Best Hits

Swiss-Prot: 98% identical to SYFA_VARPS: Phenylalanine--tRNA ligase alpha subunit (pheS) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 98% identity to vap:Vapar_1874)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>GFF4836 Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20) (Variovorax sp. SCN45)
MNELDSLVDTARAAFAEAKTPAELENAKAQFLGKSGRITELMKGMAALSVEEKKSRGAAI
NVAKQAIEAALTDRRQQLADEELSLQLRAEALDVSLPGRRRIPGGLHPVSRTLERIEEIF
SSMGFDVADGPEVESDWHSFTSLNNPPNHPARSMQDTFYVDINGDDGIPYNLRPHTSPMQ
VRYAHQHIKKYAAEFAAAAADTTGTLKAPEIRVIAPGRTYRVDSDATHSPMFHQCEGLWL
GENVSFKDLKVVFTDFCRTFFERDDLVLRFRPSFFPFTEPSAEIDIQFASGPLAGRWLEV
SGSGQVHPNVVRNMGLDPERYIGFAFGMGPDRLTMLRYGVNDLRLFFDGDLRFLSQFQ