Protein Info for GFF4834 in Xanthobacter sp. DMC5

Annotation: Regulatory protein AtoC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 87 bits, see alignment E=3.1e-28 PF00158: Sigma54_activat" amino acids 147 to 312 (166 residues), 239.7 bits, see alignment E=4.4e-75 PF14532: Sigma54_activ_2" amino acids 147 to 317 (171 residues), 61.3 bits, see alignment E=3.9e-20 PF07728: AAA_5" amino acids 170 to 288 (119 residues), 26 bits, see alignment E=2.5e-09 PF25601: AAA_lid_14" amino acids 318 to 387 (70 residues), 86.6 bits, see alignment E=2.6e-28 PF02954: HTH_8" amino acids 411 to 451 (41 residues), 40.8 bits, see alignment 4.4e-14

Best Hits

Swiss-Prot: 48% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to xau:Xaut_1032)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF4834 Regulatory protein AtoC (Xanthobacter sp. DMC5)
MPRMAAKILIVDDEVRHGEVLEAALAERGFEAVSTNTVAKALAYCASQPVDLVLSDLRMP
DRGGADLLRALKHEQPELPVIIMTAYASVRGAVDLVKDGAFDYVAKPLDLDDVVATIARA
LRLKAVESENSRLRSELEERYRFDNLLGESAVFHHVLRQVTEVAPSRASVLLLGESGTGK
ELVARAIHYNSPRRDLPFVAVNCAAIPETLIESELFGHVKGAFTGATGVREGRFAAANQG
TLFLDEIADMPLPVQAKVLRALQEQSFEPVGSSKSVSVDVRIIAATHKDLQKEIAAGTFR
MDLYYRLAVFPITLPPLRERTDDIVLLADHFLAAATRDMGKRVKGLTPEAQAMLTRYRWP
GNVRELQNCMERAAIVARGDLVGPGDLLLFEANGDTDVQSHTLNGDLDSELSRIEREFVL
QALKDSGGVQARAAEKLGITERSLWHRIKKLAIKIDKVAGAGDG