Protein Info for GFF4834 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator, AcrR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF00440: TetR_N" amino acids 8 to 53 (46 residues), 59.1 bits, see alignment E=2.9e-20 PF16925: TetR_C_13" amino acids 80 to 169 (90 residues), 34.9 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: None (inferred from 62% identity to aex:Astex_2441)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>GFF4834 Transcriptional regulator, AcrR family (Sphingobium sp. HT1-2)
VFDTDAALDKAVRLFWQRGYEATSMADLVAETGVAAASLYAAFDNKAGLFAAVIERYAAT
FSVHLYAPINDPALSTYEAVKGLLERAASSFSEPGTPAGCFMYSAAAAVSPASADIECLL
RDKRIAAEALLIERLQRGAAQGELAANTDPAVLGKFINTVMEGMSVQARDGATINELLSI
AKMALDRWPAAI