Protein Info for GFF4834 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 192 (31 residues), see Phobius details PF02417: Chromate_transp" amino acids 9 to 191 (183 residues), 109.7 bits, see alignment E=7.9e-36

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 67% identity to rfr:Rfer_2757)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF4834 Chromate transport protein ChrA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLPTPANWLDLFTHFASLSLLAVGGAITTAPDMHRYLVLQNGWLSEAQFTSSIAISQAAP
GPNVLFVAVLGWNVGLNAGGGPSAGWLAWALALFGVLVTMVAILLPSSVLTYTATRWAHQ
NRELRAVRAFKTGMAPIVIALLIATGWLLTGSHEHPARDWPLWLLTAVTTVLVWRTKMHL
LWMIGAGGLLGALGLV