Protein Info for GFF4833 in Variovorax sp. SCN45

Annotation: Translation initiation factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF05198: IF3_N" amino acids 2 to 65 (64 residues), 90.1 bits, see alignment E=8.3e-30 TIGR00168: translation initiation factor IF-3" amino acids 2 to 158 (157 residues), 203.9 bits, see alignment E=6.4e-65 PF00707: IF3_C" amino acids 72 to 156 (85 residues), 122.3 bits, see alignment E=6.4e-40

Best Hits

Swiss-Prot: 66% identical to IF3_RALSO: Translation initiation factor IF-3 (infC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 93% identity to vpe:Varpa_3947)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>GFF4833 Translation initiation factor 3 (Variovorax sp. SCN45)
MAPEVRLIGPDNEQLGVVSLAEALRLAGEQDVDLVEVVAAANPPVCRLIEYGKFKYHEQK
KAAEAKSKQKVIEVKEIKFRPGTDDGDYNIKMRNIKRFLEDGDKCKITLRFRGREITHQE
LGLALLQRIRDELGDLIMVEQFPKLEGRQMIMMIAPGRKKAGGGAPKPAADAAPAATPAT
A