Protein Info for GFF4833 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details PF02417: Chromate_transp" amino acids 21 to 182 (162 residues), 119.3 bits, see alignment E=8.7e-39

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 70% identity to pol:Bpro_3026)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF4833 Chromate transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPPAQNIPDTLPLQHPQSKTDLFVSFTWLALQGFGGVLAVVQRELVEKKRWMSREQFVED
WAVAQIMPGPNVVNLSMMIGGRYFGLPGALAALAGMLTAPMVLVLLLAALYGSVADSAVA
QNALRGMGAVAAGLIAATGIKLISALDKNAMGMGVCVFLAVLTFVAIGLLRWPLLWVLLG
IGGGACLWAYRVLSDVDADRQKKAQG