Protein Info for GFF4826 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 133 (128 residues), 59.5 bits, see alignment E=4.6e-20 amino acids 154 to 290 (137 residues), 57.3 bits, see alignment E=2.1e-19 PF06027: SLC35F" amino acids 87 to 288 (202 residues), 21.8 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_1867)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF4826 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
VAYGCLALSMSLVGGYVALSKPLVAAFPVLLLAWLRFGIAALAMPHWLKRTPDEPPMTAH
TRWLVFLESFLGNFLFSICMLFGVSLTSAVSAGVIMASIPACVAVASWLFLRERITVRIG
LAIACAALGIGLLALSPAHASATPSASPASMPWLGNLLVFCAVLCETAYAVIGKSLTGRL
GPKRIASLINLWGFVLSMPFGIWFALQFDFTAVRFGTWALLVAYALAASIWTVWLWMTGL
RNVPAAQAGVFAVLLPVSAALVGVLVLGESLSTTQLLAFVIALVGVVLATWPGRRR