Protein Info for GFF4824 in Sphingobium sp. HT1-2

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 138 to 158 (21 residues), see Phobius details PF13276: HTH_21" amino acids 47 to 103 (57 residues), 62 bits, see alignment E=1e-20 PF00665: rve" amino acids 128 to 227 (100 residues), 89.1 bits, see alignment E=4.1e-29 PF13683: rve_3" amino acids 217 to 283 (67 residues), 44.1 bits, see alignment E=3e-15

Best Hits

Swiss-Prot: 62% identical to T629_SHISO: Transposase for insertion sequence element IS629 from Shigella sonnei

KEGG orthology group: None (inferred from 82% identity to nwi:Nwi_1572)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF4824 Mobile element protein (Sphingobium sp. HT1-2)
MIAFIDDHRDAYGVEPICRVLPIAPSTYHERVAKRQDPTRLSARAQRDVALKPEVARVFA
ENFAVYGVRKVWRQMMREGFPVARCTVARLMREMGLAGVIRGKPVRTTISDKAAPCPLDH
VNRKFYAPAPNMLWVSDFTYVATWAGFVYVAFVIDTYARRIVGWRASRTAHASFVLDALE
QALHDRRPAHRGGLIHHSDRGSQYVSIKYTERLAEAGIEPSVGSVGDSYDNALAETINGL
YKAEVIHRRGPWRSFEAVEYATLEWVDWFNHRRLLESIGNIPPAEAEEQYYAAAANIDMA
A