Protein Info for GFF4819 in Variovorax sp. SCN45

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 64 to 86 (23 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 77 to 245 (169 residues), 118.9 bits, see alignment E=1.2e-38

Best Hits

Swiss-Prot: 38% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to vap:Vapar_1862)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF4819 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Variovorax sp. SCN45)
MFRKLLLSPALRPFLLILMLLVLWDLAIRLFKIPAYLIPPPWEVVKQLVAEWPHLLAESW
KTTLATLGGFGLTILIGIPIAMVIAYSRVVESYVYPLLVFSQSIPKVAIAPLFVVWFGFG
IFPKVISAFLLGFFPVVVSTVMGFKSVEPDMLDLSRSMGASRLQTFFKISLPQALPQIFS
GLKVSVTLAVVGAVVGEFVGSNSGIGYVLQVANGNFDLPLMFAALVVLSSIGVILFVAVD
LVERVMIPWHASQRHAH