Protein Info for GFF4817 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Secreted protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF11047: SopD" amino acids 44 to 359 (316 residues), 638.8 bits, see alignment E=8e-197

Best Hits

Swiss-Prot: 100% identical to SOPD_SALTY: Secreted effector protein SopD (sopD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13739, secreted effector protein SopD (inferred from 99% identity to sei:SPC_2990)

Predicted SEED Role

"Secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF4817 Secreted protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MCCINNVVQILSCSKLYLFNKKERIERYILLRILNNINLKENIMPVTLSFGNHQNYTLNE
SRLAHLLSADKEKAIHMGGWDKVQDHFRAEKKDHALEVLHSIIHGQGRGEPGEMEVNVED
INKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIE
SMSREERQLFLQICEVIGSKMTWHPELLQESISTLRKEVTGNAQIKTAVYEMMRPAEAPD
HPLVEWQDSLTADEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHSY
SPFSEFKPTNSGFLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILLT