Protein Info for PS417_24625 in Pseudomonas simiae WCS417

Annotation: (dimethylallyl)adenosine tRNA methylthiotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF00919: UPF0004" amino acids 4 to 104 (101 residues), 97.2 bits, see alignment E=7.4e-32 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 4 to 441 (438 residues), 590 bits, see alignment E=3.2e-181 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 4 to 438 (435 residues), 485.1 bits, see alignment E=1.9e-149 PF04055: Radical_SAM" amino acids 151 to 325 (175 residues), 94.1 bits, see alignment E=1.7e-30 PF01938: TRAM" amino acids 378 to 441 (64 residues), 68.3 bits, see alignment E=6.5e-23

Best Hits

Swiss-Prot: 97% identical to MIAB_PSEF5: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 99% identity to pfs:PFLU5404)

MetaCyc: 65% identical to isopentenyl-adenosine A37 tRNA methylthiolase (Escherichia coli K-12 substr. MG1655)
RXN0-5063 [EC: 2.8.4.3]

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9F1 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PS417_24625 (dimethylallyl)adenosine tRNA methylthiotransferase (Pseudomonas simiae WCS417)
MAKKLYIETHGCQMNEYDSSRMVDLLGEHQALEVTARAEDADVILLNTCSIRERAQDRVY
SQLGRWRELKLANPDMVIAVGGCVASQEGAAIRDRAPYVDVVFGPQTLHRLPEMIDAARF
TKLPQVDVSFPEIEKFDHLPEPRIDGPSAYVSVMEGCSKYCTFCVVPYTRGEEVSRPFDD
VLSEIIHLAENGVREVTLLGQNVNGYRGLTHDGRLADLAELIRVVAAVDGIERIRYTTSH
PLEFSDSLIQAHAEVPELVKHLHLPVQSGSDRILSAMKRNHTALEYKSKLRKLRAAVPGI
CISSDFIVGFPGETEKDFQQTMKLIEDVGFDFSYSFVYSQRPGTPAADLLDETPEALKKE
RLNALQHRLNQQGFEISRQMVGSTQRILVTDYSKKDPGELQGRTENNRIVNFRCDNPTLI
GQFADVHIDAAQPHSLRGSLIN