Protein Info for PS417_02455 in Pseudomonas simiae WCS417

Updated annotation (from data): putative transporter, required for glycine utilization
Rationale: PFam PF03458.9 (UPF0126). Substrate is a conserved specific phenotype of UPF0126
Original annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details PF03458: Gly_transporter" amino acids 4 to 78 (75 residues), 81.2 bits, see alignment E=2e-27 amino acids 90 to 162 (73 residues), 77.7 bits, see alignment E=2.6e-26

Best Hits

Swiss-Prot: 55% identical to Y593_CAMJE: UPF0126 membrane protein Cj0593c (Cj0593c) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU0513)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3Z3 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PS417_02455 putative transporter, required for glycine utilization (Pseudomonas simiae WCS417)
MLLMLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGHYPLTWVKH
PEYLVLTSIAALVTIFIAPLMRRLRSLFLALDAVGLVAFTLIGCMTALEMGHGMLVASVS
GVITGVFGGILRDIFCNDIPLIFRRELYASVSFLAAWFYMLCLYLELPSEQAILLTLFSG
FLLRLLAIRFHWEMPKFVYNDDVH