Protein Info for GFF481 in Variovorax sp. SCN45

Annotation: Glycine betaine/L-proline transport system permease protein ProW (TC 3.A.1.12.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 115 to 136 (22 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 210 to 239 (30 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 181 to 347 (167 residues), 101 bits, see alignment E=3.6e-33

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 89% identity to vpe:Varpa_3412)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>GFF481 Glycine betaine/L-proline transport system permease protein ProW (TC 3.A.1.12.1) (Variovorax sp. SCN45)
MNDTTLPSELAPLNDAASTLATPAPMPAPVDPWEAMSAAPDPASTSAWLDAPAHTAHQMA
GQADAATGGFQLHRLWDGSLPIESWINQGLGWVVEHFRPFFQTVRLPIDSTLNSVQSLLT
GLPTLAMIALIGLFAWQFAGRALAIGTTVALLLVAMLGIWPEAMVTLSLVLTSLVFCMVI
GLPLGVLLASSDRAQRIMRPVLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIIFALAPL
VRLTNLGLRQVRPDLIEAARAYGASPWQMLVKVQLPLAMPSIMAGINQALMLSLSMVVIA
SMIAVGGLGQMVLRGIGRLDMGLATVGGLGIVLLAISLDRLTQAMGKSRRAGGRRWWHTG
PVGFALRMLQRAVAPSRAAGEPVPALSTQAQ