Protein Info for GFF4806 in Variovorax sp. SCN45

Annotation: Arsenate reductase (EC 1.20.4.1) glutaredoxin-coupled, glutaredoxin-like family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00014: arsenate reductase (glutaredoxin)" amino acids 12 to 124 (113 residues), 137.7 bits, see alignment E=1.2e-44 PF03960: ArsC" amino acids 15 to 122 (108 residues), 77.4 bits, see alignment E=8.4e-26

Best Hits

Swiss-Prot: 56% identical to ARSC2_ECOLX: Arsenate reductase (arsC) from Escherichia coli

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 90% identity to vap:Vapar_1852)

MetaCyc: 55% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF4806 Arsenate reductase (EC 1.20.4.1) glutaredoxin-coupled, glutaredoxin-like family (Variovorax sp. SCN45)
MTARTPTTDYPMTIYHKPNCSTSRNVLQLIRESGVEPEIVLYLETPPSKKKLRELAKAMG
LGARDLLRAKEAPYEELGLADEKLSDDQLFDAIVAHPILLQRPIVVSPRGTLMCRPWQRV
EEILPAKKSQAAS