Protein Info for GFF4801 in Xanthobacter sp. DMC5

Annotation: 2-(R)-hydroxypropyl-CoM dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00106: adh_short" amino acids 7 to 199 (193 residues), 177.5 bits, see alignment E=5.4e-56 PF01370: Epimerase" amino acids 10 to 99 (90 residues), 25.4 bits, see alignment E=2.2e-09 PF08659: KR" amino acids 10 to 169 (160 residues), 32.1 bits, see alignment E=2.8e-11 PF13561: adh_short_C2" amino acids 13 to 248 (236 residues), 212.1 bits, see alignment E=2.2e-66 PF23441: SDR" amino acids 32 to 195 (164 residues), 32.4 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 36% identical to HCDR_XANP2: 2-(R)-hydroxypropyl-CoM dehydrogenase (xecD) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: None (inferred from 53% identity to bpy:Bphyt_6456)

MetaCyc: 36% identical to 2-(R)-hydroxypropyl-CoM dehydrogenase subunit (Xanthobacter autotrophicus Py2)
2-(R)-hydroxypropyl-CoM dehydrogenase. [EC: 1.1.1.268]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.268

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF4801 2-(R)-hydroxypropyl-CoM dehydrogenase (Xanthobacter sp. DMC5)
MARLDGKVAFITGAAGGIGRETCARYIAEGARVAAIDIGSDALDETLQHADAGENGIAIV
CDITEPQQVKDAIAQAVARFGRIDVLCNIAGGSTTADARVTEAPDEEFWRAIRLDLYGTF
LCCKHAIPEIARAGGGSVINLSSMVALMALPERDCYTAAKGGVAAMTRSMAVEYAPNRIR
VNAIAPGLVLTPRVEGLMETREELRQLVGQHLLGPCRPGDIAGMAVYLGSDDARVVTGQV
LSVDSGVTIS