Protein Info for PS417_24560 in Pseudomonas simiae WCS417

Annotation: ferrous iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 289 (275 residues), 201.8 bits, see alignment E=6.9e-64 PF01545: Cation_efflux" amino acids 17 to 208 (192 residues), 136 bits, see alignment E=1.5e-43 PF16916: ZT_dimer" amino acids 212 to 288 (77 residues), 77.4 bits, see alignment E=7.4e-26

Best Hits

Swiss-Prot: 48% identical to FIEF_YERE8: Cation-efflux pump FieF (fieF) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU5391)

MetaCyc: 46% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7US31 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PS417_24560 ferrous iron transporter (Pseudomonas simiae WCS417)
MTSSPEHARLLRLATRASVGVACALIITKSIAWWFSGSVSMLAGLTDSLLDGVTSLLNLL
AVHYALRPADDDHRYGHGKAESLAGMAQALFIGGSAVLIALQAYERLQHPEPVGAPWLSI
GVIVFSLVLTVALLMLQHRVIRETGSNAVRADSLHYRSDLMLNGSILVALVVAGFGYHQV
DAWFGLGIAAYILWSAIQIARESFAVLMDEELPPDVSQHMLELARGVPGVLGAHDLRTRI
SGSHWFVQLHLELPGELTLSVAHGISDQAADAIHKAYPRAEVLVHADPREVVTGNKT