Protein Info for GFF480 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 29 to 406 (378 residues), 25 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 88% identical to YHJV_ECOLI: Inner membrane transport protein YhjV (yhjV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sei:SPC_3703)

MetaCyc: 45% identical to L-cysteine importer (Escherichia coli K-12 substr. MG1655)
RXN-23966

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF480 Serine transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQDDTLPLNNSNATTTPLSTRLPFTKYDFGWVLLCIGMAIGAGTVLMPVQIGLKGIWVFI
TAFIIAYPATYIVQDIYLKTLSESETCDDYTDIISHYLGKNWGIFLGVIYFLMIIHGVFI
YSLSVVFDSASYIKTFGLTEADLSQSIIYKVAIFAVLVAIASGGEKLLFKISGPMVVVKV
GIILIFGFAMIPHWNLDNISAFPAASVFFRDVLLTIPFCFFSAVFIQVLNPMNIAYRKRE
PDRVLATRMAIRTHRISYITLIAIILFFSFSFTFSISHEEAVSAFEQNISALALAAQVIP
GHIIHITSTILNIFAVLTAFFGIYLGFHEALKGIVLNVLSRIMDVKNVNPLLLTSGICVF
IVVTLVIWVSFRVSVLVFFQLGSPLYGIVACIIPFFLIYKVAQLEKLRGLKTWLILLYGI
LLCLSPLLKLIE