Protein Info for GFF4797 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Polyhydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I
  • amino acids 96 to 611 (516 residues), 698.9 bits, E=1.9e-214
• PF07167: PhaC_N
  • amino acids 126 to 292 (167 residues), 217.8 bits, E=8.2e-69
• PF00561: Abhydrolase_1
  • amino acids 269 to 533 (265 residues), 101 bits, E=8.7e-33

Best Hits

Swiss-Prot: 63% identical to PHAC_CUPNH: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 77% identity to rfr:Rfer_2562)

MetaCyc: 63% identical to poly-beta-hydroxybutyrate polymerase subunit (Cupriavidus necator)
RXN1-42 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

• polyhydroxybutanoate biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Protein Sequence (614 amino acids)

>GFF4797 Polyhydroxyalkanoic acid synthase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTSGKTPSSDWLETAQQFQQNLVQQWTQMAQAFPGASAPPSAASDPFAAFKAFMPKAGAA
NPFGMAMPTGTAAFPGMPAVGDIFSQASQGQAVSFDPAQLLEIQNTYLKELAGLWNQGPN
VKPAGDRRFASDAWASNPMAAFAAAAYLLNARTLMAMAEAVQGDAKARTRVRFAVQQWID
ASAPSNFLAFNAEAQKKAIETQGESIAKGVANLLHDMKQGHVSMTDESVFEVGKNVATTE
GAVVFENELFQLIEYKPLTAKVYERPFLLVPPCINKFYILDLQPENSLIRYCVEQGHRTF
VVSWRNPDESLSHKTWDEYIEDAVIKAIAVTQDVTGAETINALGFCVGGTMLGTALAVLA
ARGEEPVNSVTLLTTLLDFSDTGILDVFIDENFVKFREMQFADGGLMPGRDLATTFSFLR
PNDLVWNYVVGNYLKGETPPPFDLLYWNSDSTNLPGPYYAWYLRQMYLENNLIKPGKTTV
CGEKIDFRQVKLPVYIYGSREDHIVPIGGAYGSTQIFPGKKRFVMGASGHIAGVINPASK
NKRSHWIGPAGKFPADVKDWVAGATEHPGSWWTDWSAWLKPLAGKQIAAPKAYGKAKRYT
AIEPAPGRYVKAKA