Protein Info for GFF4795 in Pseudomonas sp. DMC3

Annotation: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 8 to 200 (193 residues), 189 bits, E=1.4e-59
• PF08659: KR
  • amino acids 10 to 163 (154 residues), 36.3 bits, E=1.1e-12
• PF13561: adh_short_C2
  • amino acids 14 to 251 (238 residues), 239.1 bits, E=1e-74
• PF23441: SDR
  • amino acids 55 to 250 (196 residues), 39.5 bits, E=9e-14

Best Hits

Swiss-Prot: 45% identical to LINC_SPHIB: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (linB) from Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_4194)

MetaCyc: 42% identical to cyclohexanol dehydrogenase (Acinetobacter sp. SE19)
Cyclohexanol dehydrogenase. [EC: 1.1.1.245]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• cyclohexanol degradation (2/5 steps found)

KEGG Metabolic Maps

• Caprolactam degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.245

Protein Sequence (253 amino acids)

>GFF4795 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (Pseudomonas sp. DMC3)
MSMTFSGQVVVITGAAYGIGRATALAFAAEGLKVVVADLDAAGGEGTVALIRTAGGEASF
VRCDVTVESDVKNLMDEVINTYGRLDYAFNNAGIEIEKGKLADGTLDEFDAIMGVNVKGV
WLCMKYQLPLLLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI
RVNAVCPAVIDTDMFRRAYEADPKKGEFANAMHPVGRIGKVEEIASAVLYLCSDGAAFTT
GHSLAVDGGVTAF