Protein Info for GFF4794 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TrkA-N:Sodium/hydrogen exchanger

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 261 (32 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 371 to 389 (19 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 387 (374 residues), 227.3 bits, see alignment E=2.8e-71 PF02254: TrkA_N" amino acids 430 to 542 (113 residues), 91.3 bits, see alignment E=5.4e-30

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 82% identity to vpe:Varpa_3854)

Predicted SEED Role

"TrkA-N:Sodium/hydrogen exchanger" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>GFF4794 TrkA-N:Sodium/hydrogen exchanger (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPHSISLINTIAAGLGLALILGFLAAKVRLPALVGYLLAGVIIGPFTPGFVADAGIAAQL
AEIGVMLLMFGVGLHFSLDDLLSVRKIALPGAVVQMAVATLMGVGMAMWWWDWSFGSALV
FGISLSVASTVVLLRALESLGILDSFTGRIAVGWLVVEDLAMVLVLVLLPPLAGFLGGTG
SDSDLDSIWRALGFTLLQVGGFVALMLVVGRRVFPWLLWQVARTGSRELFTLCVVAAAVS
IAFASAALFGVSFALGAFFAGMVLRESEFSHRAAEESLPLRDAFAVLFFVSVGMLFNPAV
LIERPLQVLGVVLIIIVGKSVAAAALVVAMRYPLNTALTVSASLAQIGEFSFILVGLGAS
LGLLPPEGQSLVLAGALISIATNPLWFKAINPLQEWLRKNSEFARKLEQRDDPLAELPMT
THEKFLSRQVVLVGYGRVGRRIAAALEEQNLPYVVAEENRDIVERLRERGIAAVFGDAAD
PAVLIQAHIARAGMLVIATPDTLNVRQMIATARTLNPDIQTVVRTHSEEEASLLEKEVAG
KVFLGEEELAQSMTRYVLEHSRVANAGARAAA