Protein Info for GFF4792 in Sphingobium sp. HT1-2

Annotation: Xaa-Pro dipeptidase family enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01979: Amidohydro_1" amino acids 80 to 433 (354 residues), 167 bits, see alignment E=7.1e-53 PF07969: Amidohydro_3" amino acids 233 to 415 (183 residues), 32.4 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: None (inferred from 70% identity to swi:Swit_2224)

Predicted SEED Role

"Xaa-Pro dipeptidase family enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF4792 Xaa-Pro dipeptidase family enzyme (Sphingobium sp. HT1-2)
MIWGKAAALAACSMAALVAMSAPAVMAKDVVVHAGRMIDGTGAAAREKVSILIHDDRITA
IQSGFVTPAGAEVIDLSAKTVLPGLIDTHDHITAGWHSGDPIRNAVTRSAYEDAIEATGF
VRNTLLAGFTSVRDCGADTQVIVALKKSIDGAVIPGPRLWVAGTPLGPTGGHGDAVNGLR
VEFADIPHISDNVIDSPEAARIAVRRLKREGADLIKIMPSGGVMSIGDDPKHQLMTDEEI
KAVIDTAHSLGMKVAAHAHGKEAIDHTIALGVDSIEHGSYADAGSYKIFKQYGAYLVPTM
LVGERVYQRAREHPEQLNPSTAEKALVIGPLLQKNLRDAYAAGVKIAFGTDTFGLSDHGE
NAQEFALMVRAGMPAMEAIKAATANAADLLGSADVGTLQAGRYADLIAVDGDPLADVRQL
EKVGFVMKGGAVVKADGKPMI