Protein Info for GFF4791 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 import ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 251 to 276 (26 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 306 (264 residues), 112.8 bits, see alignment E=2.6e-36 PF00005: ABC_tran" amino acids 371 to 513 (143 residues), 95.5 bits, see alignment E=6.7e-31 PF12399: BCA_ABC_TP_C" amino acids 563 to 586 (24 residues), 35.1 bits, see alignment (E = 1.2e-12)

Best Hits

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>GFF4791 Vitamin B12 import ATP-binding protein BtuD (Xanthobacter sp. DMC5)
MTVLSRFVRSQTATALVAMWLAITAAALLLDGYWIGIMVGLLGWILLAASWNMVGGLLGQ
VSFGHSAFFGLGAYTAVYLATAHGISPWLGMLIGGLLAALFSMIVGYLPFRRGLSPLVFS
LLTLASSYVLLFAVSGIPALGGTNGLFPPAVGQSVWDMRFDSPVSYLLLAGALTTFALAT
IQILYSGRLGFYWRAIHDSEAAAGAIGINTMAVKLFTFAVSAFFAAMAGTFSAQHTGFID
PQSVFGVEITIYLLLFAVVGGAGSLLGPVLGPLVLVPAGEYLRTALANAGGSSAHHLIYG
IALMIAILSFPGGLVAGLRRFGVTRGALSLPDLARAAGPAPGARRSDTAKGSEILKASGV
SKNFGGVFAVRDVSIDVRSGEILGIIGPNGAGKTTLFSLLAGSLKPSSGSITFDGRQIAG
LPSHEICRAGIGRTFQITRAFPTLTVAETVYAAALVGRPEGEAAAIAGSVLSLTRLDPYR
DVASADVTLAVQRRLEIARALATRPRLILLDEIMAGLTPREINDAIELIRSIRDSGVTVI
FIEHHIRAVMALSDRIVVLDAGELIAEGVPSDVARDPRVVEAYLGRPTEEPALPPLDEVK
AR