Protein Info for GFF4789 in Pseudomonas sp. DMC3

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details PF01810: LysE" amino acids 20 to 210 (191 residues), 119.8 bits, see alignment E=5.5e-39

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_4189)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF4789 Threonine efflux protein (Pseudomonas sp. DMC3)
MLSNYLGEFLALATIHFLAVIAPGPDFAVTIRQSVRFGRLVGICTALGIGAGISVHVLYT
LLGVGALMHTTPWLLTVAKVVGGAYILYLGVSLIRSKPKSSVDGEKTADEPLVEQSLFKA
FSTGFLTNATNPKATLFFLAIFTTIISASTPLQIQAFYGLWMCFVNALWFVIVALFFSSN
KVRLLFMRLGHWFERSMGVILILFAGRLMLSM