Protein Info for GFF4786 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: UbiD family decarboxylase, MJ1133 type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 TIGR00148: decarboxylase, UbiD family" amino acids 6 to 441 (436 residues), 416.9 bits, see alignment E=4.5e-129 PF20695: UbiD_N" amino acids 11 to 90 (80 residues), 53.2 bits, see alignment E=3.8e-18 PF01977: UbiD" amino acids 113 to 309 (197 residues), 183.3 bits, see alignment E=4.9e-58 PF20696: UbiD_C" amino acids 315 to 438 (124 residues), 110.4 bits, see alignment E=9.4e-36

Best Hits

Swiss-Prot: 98% identical to YCLC_ECO57: Phenolic acid decarboxylase (edcC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to sec:SC2852)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF4786 UbiD family decarboxylase, MJ1133 type (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAFDDLRSFLHALDQQGQLLKISEEVNAEPDLAAAANATGRIGDGAPALWFDNIRGFTDA
RVAMNTIGSWQNHAISLGLPPNTPVKKQIDEFIRRWDNFPVAPERRANPGWAENTVDGDA
INLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVGIYRMEVKGKRKLGLQPV
PMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYDQSEYEMAGALRESPYPIA
TAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTGHYSGGRNMTVVRIDKVSYRSKPI
FESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVNAMYTHGLLAIISTKKRYGGF
ARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWALSSKVNPAGDLVQLPNMSVLE
LDPGSSPAGITDKLIIDATTPVAPDNRGHYSQPVVDLPETKAWAEKLTAMLANRK