Protein Info for GFF4781 in Variovorax sp. SCN45

Annotation: AttH component of AttEFGH ABC transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07143: CrtC" amino acids 46 to 216 (171 residues), 207.3 bits, see alignment E=2.4e-65 PF17186: Lipocalin_9" amino acids 220 to 349 (130 residues), 142 bits, see alignment E=1.2e-45

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_3995)

Predicted SEED Role

"AttH component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF4781 AttH component of AttEFGH ABC transport system (Variovorax sp. SCN45)
MTPSSFALSRRALLLAALCAAPTAWALPLRTLQFPRDFGSHPDLHTEWWYITGHAKTATG
REFGFQVTFFRSRVEATQGMRSAFAAKNLVFAHAAVTDLEGRVLLHDQRIARAGFGVAQA
SEADTDVRIRDWSLVREGGVYVARIPAGEFMLDLRFTPTQPVLLQGNAGLSRKGPDESQA
SYYYSEPQLKAQGKLTLKGQAFEVNGAAWLDHEWSEALMHPEAVGWDWIGMNLDDGSALT
AFHLRRADGSGLWAGGSFRPRDGVARIFRNDEVRFESLKTWESPRTQAKYPTQWRVRTPA
GNFEVRALLDDQELDSRGSTGGVYWEGVSDLLDAQGQRVGRGYLEMTGYAAPLKL