Protein Info for PS417_24450 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 34 to 51 (18 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 397 (358 residues), 179.7 bits, see alignment E=3.9e-57

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 96% identity to pfs:PFLU5368)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6Y2 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PS417_24450 membrane protein (Pseudomonas simiae WCS417)
MPLQNSALAARHGTPHAGIGDKIRGALAVGKTRWGMLALVFFATTLNYIDRAALGVMQPI
LAKEMSWTAMDYANINFWFQVGYAIGFVLQGRLIDRVGVKRVFFCAVLLWSLATGAHGLA
TSAVGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGIFNAGTNVGAMMTPMLLP
LILHVWGWQAAFLCMSALGGIWLVFWGLKYFNPEDHPSVKQSELDYVLQEAEPEQPRVPF
TRILRMRGTWAFALAYSMTAPVFWFYLYWLPPFLNQQYNLGINVTQMGIPLIIIYLTADF
GSVGGGILSSFLIGRGMNSIKARLLSMLLFACCIVGVIMAAGSSQLWVAVFAISLAIGAH
QAWTANIWSLVMDYTPKHMMSTVFGFGGMCAAIGGMFMTQIVGHILTVTNNNYTVLFTLI
PAMYFIALTWMYFMAPRKIPTVDV