Protein Info for GFF4779 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Intracellular PHB depolymerase (EC 3.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR01849: polyhydroxyalkanoate depolymerase, intracellular" amino acids 2 to 418 (417 residues), 570.1 bits, see alignment E=1.2e-175 PF06850: PHB_depo_C" amino acids 213 to 419 (207 residues), 303.6 bits, see alignment E=3e-95

Best Hits

KEGG orthology group: K05973, poly(3-hydroxybutyrate) depolymerase [EC: 3.1.1.75] (inferred from 80% identity to dia:Dtpsy_1886)

Predicted SEED Role

"Intracellular PHB depolymerase (EC 3.1.1.-)" in subsystem Polyhydroxybutyrate metabolism (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.1.75

Use Curated BLAST to search for 3.1.1.- or 3.1.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>GFF4779 Intracellular PHB depolymerase (EC 3.1.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLYQIYETQRSIMEPFADLAEVASKLFTNPMLPLAQLPGAQRISAGYDLMHRLGKDYEKP
VFGIHTVDVDGVDVAIHERIEIDKPFCELRRFKRFSDDTDTLAKLKGQPVVLIVAPLSGH
YATLLRDTVRTMLKDHKVYITDWKNARLVPLADGEFHLDDYVNYIQAFIRYLQEGYGNCH
VMSVCQPTVPVLAAVSLMASRGETTPLSMTMMGGPIDARKSPTAVNNLATQRSYEWFENN
VIYRVPDNFPGAGRRVYPGFLQHTGFVAMNPDRHASSHYDYFKDLIKGDNSSAESHRKFY
DEYNAVLDMDADYYLETIETVFQEFKLVNGTWDVRNEQGELERVRPQDIQRTALLTVEGE
LDDISGAGQTAAAHDLCTGIAKTHQMHYEAQGAGHYGIFSGRRWRDMVHPVVKSFIKAHQ
PAVDAKPAAKPAAKVAARKPAAKAPAPARKTTGRKTAKA