Protein Info for GFF4778 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF04321: RmlD_sub_bind" amino acids 1 to 161 (161 residues), 50.7 bits, see alignment E=3.5e-17 PF01370: Epimerase" amino acids 3 to 208 (206 residues), 99.2 bits, see alignment E=6.6e-32 PF16363: GDP_Man_Dehyd" amino acids 4 to 159 (156 residues), 68.1 bits, see alignment E=2.5e-22 PF01073: 3Beta_HSD" amino acids 4 to 177 (174 residues), 57.1 bits, see alignment E=3.8e-19 PF07993: NAD_binding_4" amino acids 44 to 176 (133 residues), 30.4 bits, see alignment E=5.7e-11

Best Hits

Swiss-Prot: 56% identical to DEND_HAEIN: D-erythronate dehydrogenase (denD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to stm:STM2914)

MetaCyc: 56% identical to D-erythronate 2-dehydrogenase (Haemophilus influenzae Rd KW20)
RXN-18591 [EC: 1.1.1.410]

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF4778 Nucleoside-diphosphate-sugar epimerases (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQIIITGGGGFLGQKLASALLNSSLAFNELLLVDLKMPARLSDSPRLRCLEADLTQPGVL
ESVITANTSVVYHLAAIVSSHAEDDFDLGWKVNLDLTRQLLEACRRQPQKIRFVFSSSLA
VYGGTLPECVTDTTALTPRSSYGAQKAACELLVNDYTRKGYVDGLALRLPTICVRPGKPN
RAASSFVSAIIREPLQGETTVCPVSESLRLWISSPATVIHNLSLAATLPAPGEASSINLP
GISVTVGEMLETLCQAGGQAARDRVTHQRDEGVEKIVASWPGRIDNQRALALGFVADKRF
DDIIERFRQDDMEGRS