Protein Info for GFF4775 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Possible membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 203 to 229 (27 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 347 (336 residues), 147.2 bits, see alignment E=3e-47 amino acids 224 to 386 (163 residues), 42.1 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to sei:SPC_2953)

Predicted SEED Role

"Possible membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF4775 Possible membrane transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTYRSKVAVVYLLGFFLDLINLFIASVAFPAMSVDLHTSISALAWVSNGYIAGLTLIVPF
SAFLSRYLGARRLIIFSLILFSVAAAAAGFADSLHSLVFWRIVQGAGGGLLIPVGQALTW
QQFKPHERAGVSSVVMMVALLAPACSPAIGGLLVETCGWRWIFFATLPVAVLTLLLAYRW
LNVASTTMASARLLHLPLLTDRLLRFAMIVYLCVPGMFIGISVVGMFYLQNVAQLSPAAA
GSLMIPWSIASFVAIMLTGRYFNRLGPRPLIIVGCLLQAAGILLLTNVTPATSHRVLMMI
FALMGAGGSLCSSTAQSGAFLTIARRDMPDASALWNLNRQISFFLGATLLTLLLNALQRV
MSLEVAYRWTFIAAAGITLLPLIYAVCLNNRQALLCLKKERS