Protein Info for GFF4774 in Variovorax sp. SCN45

Annotation: Broad-specificity amino acid ABC transporter, ATP-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 161 (142 residues), 92.7 bits, E=1.6e-30

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 97% identity to vpe:Varpa_4001)

MetaCyc: 33% identical to lipopolysaccharide transport system ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-128 [EC: 7.5.2.5]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

MetaCyc Pathways

• Brucella abortus lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (235 amino acids)

>GFF4774 Broad-specificity amino acid ABC transporter, ATP-binding protein 2 (Variovorax sp. SCN45)
MTAALEIKGLQAWYGESHVLHGVDMVVQPGEVVTLLGRNGAGRTTTLRAIMGLTGARKGS
IEVNGKETIGMPTHRIAHLGIGYCPEERGIFASLSCEENLMLPPELKGAGQGMSVDEIYA
MFPNLAERRHSQGTRLSGGEQQMLAVARILRTGAKLLLLDEISEGLAPVIVQALARMITT
LRAKGYTIVMVEQNFRFAAPLADRFYVMEHGRIALKFGASELEAKMPVLTELLGV