Protein Info for GFF4773 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Protein-tyrosine kinase (EC 2.7.1.112)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR03018: exopolysaccharide/PEP-CTERM locus tyrosine autokinase" amino acids 69 to 277 (209 residues), 285.9 bits, see alignment E=6.9e-90 PF10609: ParA" amino acids 106 to 229 (124 residues), 30.2 bits, see alignment E=4.8e-11 PF13614: AAA_31" amino acids 108 to 268 (161 residues), 35.3 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: K00903, protein-tyrosine kinase [EC: 2.7.10.-] (inferred from 66% identity to rfr:Rfer_0660)

Predicted SEED Role

"Protein-tyrosine kinase (EC 2.7.1.112)" (EC 2.7.1.112)

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.-

Use Curated BLAST to search for 2.7.1.112 or 2.7.10.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF4773 Protein-tyrosine kinase (EC 2.7.1.112) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSLIEKAAQRLEQLRQAGADMPAAPEATAPEVAAPAPAAARPAPVKEAPKTVSKAVRLD
LAALTEAGFVTPNAPRAVIADQYRVIKRPLIANATGKGASVVQHGNRIMVTSAMPGEGKS
FTAINLAMSIAMELDYTVLLVDADVSRPSIMKTLGLPPGPGLLDLLTNKQMEMSDTLLRT
NVDKLSLLPSGTPHPRATELLASDAMTDLIEEMGHRYPDRIIIFDSPPLLLTTESRVLAT
HMGQIVVVVQAEKTLQSQVRHALTTIESCPIKLMVLNQVHGGDQDAYGYGYGYGHGASSE
AQASEATPA