Protein Info for PS417_24410 in Pseudomonas simiae WCS417

Annotation: ligand-gated channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 885 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07660: STN" amino acids 66 to 116 (51 residues), 41.6 bits, see alignment 1.2e-14 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 121 to 885 (765 residues), 550.3 bits, see alignment E=7.3e-169 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 127 to 885 (759 residues), 703.9 bits, see alignment E=2.4e-215 PF07715: Plug" amino acids 141 to 249 (109 residues), 69 bits, see alignment E=6.9e-23 PF00593: TonB_dep_Rec_b-barrel" amino acids 397 to 854 (458 residues), 153.3 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 76% identity to pfl:PFL_5378)

Predicted SEED Role

"Hemophore HasA outer membrane receptor HasR / Iron siderophore receptor protein" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1N9 at UniProt or InterPro

Protein Sequence (885 amino acids)

>PS417_24410 ligand-gated channel (Pseudomonas simiae WCS417)
MSALNKGRITVSRLALAIHVGLFAAAAPVYAAQPAVKAAQPAVLMLDIPAQSLGSAVLAF
ADQAGLQVLFDSQRLAGLQSTTVNGQYSVQEGLARLLGNAPVEYRFNGERQVTLTRVEQS
GAALALATTTITGLHPNDWVYSTPRSVSVVGREQLDRNPPRHAAEMLEEAPGVYSAVSQQ
DPGLSVNIRGIQDYGRVNMSVDGMRQNYQQSGHQQRNGTLYVDSELLSEVVIEKGATSTM
GGAGVIGGVANFRTVEAADLLKDGKEIGGRIRVTTGLGGRSNGTHFIGSSAFAVGTDVWD
MLLAASERHLGDYNPGTKGSIGDLRTGTSFLPNSQERIKNTTVAYSGSVMRSRLLKLGIN
LPVDQRLQLSYLTTAVGYDDVNMMSAEKAQLWEKLGSSDVTAQNVALDYSYTPDNPLIDF
KAKLYYVDTRNDQSTLTRGSSKGYEVTYQTNTYGFQAQNMSTFALSELSVIKANYGLEFF
YDKVRPDSNQMVASDSAVTASAAESVTPKGDRAMGSLFTRLDYDYDNWLNLNAGLRYDRY
RLRGETGLNTRTFIIGTTRQVGLPMTYDVDREEGHFSPTFGLSIKPGVDWLQLFATYGKG
WRPPAVTETLVSGRPHGGGSESIFPNPFLKPETSTAWEVGFNVLKEDLLFADDRAGMKVS
YFNTRVDDFSYMALGVQPPGYGIANIGNAAYVNNLETTRFRGLEYQLDYDAGFAYGQFNY
TRMLGSNRFCSKTAWLGGVTKIQKGPGSRAPVTAMVPDDVANAGQGCSAILGSSEHMPMD
RGTATLGARFFERKLDVGVRARYSGGYYVKGGVGVTTSQTGVYPADWKPYTVYDLYSSYR
ATDQLTLRLAMENVTDRAYLVPLGDVLAFTLGRGRTLQGTVEYQF