Protein Info for PS417_24405 in Pseudomonas simiae WCS417

Annotation: heme acquisition protein HasAp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF06438: HasA" amino acids 1 to 206 (206 residues), 238.2 bits, see alignment E=3.7e-75

Best Hits

Swiss-Prot: 47% identical to HASA_SERMA: Hemophore HasA (hasA) from Serratia marcescens

KEGG orthology group: K12545, heme acquisition protein HasA (inferred from 71% identity to pfl:PFL_5377)

Predicted SEED Role

"Hemophore HasA" in subsystem Protein secretion by ABC-type exporters or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7URX3 at UniProt or InterPro

Protein Sequence (206 amino acids)

>PS417_24405 heme acquisition protein HasAp (Pseudomonas simiae WCS417)
MSISISYSTTYAASTVAEYLSDWSAYFGDLNHREGSVKEGSNTGGFNPGPFDGTQYGVSS
TVSNAAVVANGDLHYTLFNPPSHTLWGSIDSLDLGTVLTGGAAGGSYALGEQEVSFANLG
LSSLQSEGRDGQVHKIVYGLMSGDSSVLASAIDSLLKDIDPNLSINSTFDQLAAAGVAHV
DSASVAASDVALVGVQDVPQDFALAA