Protein Info for GFF4770 in Variovorax sp. SCN45

Annotation: Multidrug efflux system EmrAB-OMF, membrane fusion component EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details PF25917: BSH_RND" amino acids 67 to 268 (202 residues), 44.9 bits, see alignment E=1.2e-15 PF25885: HH_EMRA" amino acids 103 to 236 (134 residues), 102.4 bits, see alignment E=3.2e-33 PF25876: HH_MFP_RND" amino acids 140 to 200 (61 residues), 31.2 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 46% identical to FARA_NEIGO: Fatty acid resistance protein FarA (farA) from Neisseria gonorrhoeae

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 92% identity to vap:Vapar_3490)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>GFF4770 Multidrug efflux system EmrAB-OMF, membrane fusion component EmrA (Variovorax sp. SCN45)
MSDNNTPTPAAAAAPAAPEAPAGNGKRRRALTALAAVVIVAGGGWGLYEWLVASHYEDTD
NAYVSGNVIQITPQIGGTVMSINADDTDFVKAGQPLVQLDPADAKVALEQAEAALAQAVR
QVRTLYANNGSLAAQVTLRQSDIVKAQSDIAKAQDDLQRRRALSGNGAVSKEELNHAETA
LDTAKSQLAAAQAGVIAAKEALVSNQSLTEGTSVAQHPSVLAAAAKVREAYLATQRVAMP
APVDGYVAKRTVQLGQRVAAGTPMMSIVPLNQLWVDANFKEVQLRNIRIDQPVKLTADVY
GKKVEYTGKVAGLGVGTGSAFALLPAQNATGNWIKVVQRVPVRIALDPEQLKANPLRIGL
SMDAEVDISSKSGKMLADAPRPAALVQTQVYSQLDRGADAEVDRIVAANLGRSAPATATA
PAKGSAAPAGASVAVQGQPG