Protein Info for GFF4765 in Pseudomonas sp. DMC3

Annotation: Ribosomal large subunit pseudouridine synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00005: pseudouridine synthase, RluA family" amino acids 35 to 327 (293 residues), 260.4 bits, see alignment E=1.1e-81 PF01479: S4" amino acids 38 to 84 (47 residues), 35.7 bits, see alignment 5.8e-13 PF00849: PseudoU_synth_2" amino acids 119 to 267 (149 residues), 107.8 bits, see alignment E=6.3e-35

Best Hits

Swiss-Prot: 80% identical to RLUC_PSEAE: Ribosomal large subunit pseudouridine synthase C (rluC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 95% identity to pba:PSEBR_a4058)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF4765 Ribosomal large subunit pseudouridine synthase C (Pseudomonas sp. DMC3)
MIKCFNSIKIVIIRGMTTTAPSTPGVQLLEVSPEYAGQRIDNFLLARLKGVPKTLIYRIL
RKGEVRVNKGRIKPEYKLQAGDIVRVPPVRVPERDEPVPLAQGLLQRLEASIVFEDKALI
VINKPAGIAVHGGSGLNFGVIEAFRQLRPDAKELELVHRLDRDTSGLLMIAKKRSMLRHL
HEQLRGDGVDKRYMALVRGNWATSIKQVRAPLLKSNLRSGERMVEVNDEGKEALTLFKVL
RRFGDFATMVEAKPVTGRTHQIRVHTLHAGHCIAGDSKYGDEDFTKEIRDLGGKRLFLHA
YMLTVPLPDGGKLNLQAPVDEMWAKTVERLSAPI