Protein Info for PS417_24370 in Pseudomonas simiae WCS417

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 22 to 68 (47 residues), 31.5 bits, E=1.4e-11
• PF01799: Fer2_2
  • amino acids 88 to 160 (73 residues), 107 bits, E=4.2e-35

Best Hits

Swiss-Prot: 44% identical to DCMS_HYDPS: Carbon monoxide dehydrogenase small chain (cutS) from Hydrogenophaga pseudoflava

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 95% identity to pfs:PFLU5350)

MetaCyc: 47% identical to 1-testosterone hydratase/dehydrogenase gamma subunit (Steroidobacter denitrificans)
RXN-21494 [EC: 1.17.99.11]; 1.17.99.11 [EC: 1.17.99.11]; 1.17.99.11 [EC: 1.17.99.11]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

MetaCyc Pathways

• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.11

Sequence Analysis Tools

See A0A1N7U9A3 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PS417_24370 (2Fe-2S)-binding protein (Pseudomonas simiae WCS417)
MSATPNGAAAQPFVSHSIRLSLNGQERQLDVLPWTTLLDLLREQLDLVGSKKGCDHGQCG
ACTVLRDGKRINACLTLAVMCDGAELTTIEGLANGDQLHPMQQAFIKHDAFQCGYCTPGQ
ICSAVGLANEGRAHDTAQIQELMSGNLCRCGAYNNIRDAIVDVVGGEQ