Protein Info for GFF4764 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF21304: T3S_SPI-1_N0" amino acids 1 to 55 (55 residues), 86 bits, see alignment 2.5e-28 PF03958: Secretin_N" amino acids 62 to 121 (60 residues), 34.5 bits, see alignment E=3e-12 amino acids 136 to 254 (119 residues), 45.5 bits, see alignment E=1.1e-15 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 208 to 471 (264 residues), 349 bits, see alignment E=1.7e-108 PF00263: Secretin" amino acids 310 to 468 (159 residues), 114.4 bits, see alignment E=6.4e-37

Best Hits

Swiss-Prot: 100% identical to INVG_SALTY: Protein InvG (invG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 99% identity to stt:t2800)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>GFF4764 Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMR
NAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDK
QNDGIELGRQKIGVMRLNNTFVGDRTYNLRDQKMVIPGIATAIERLLQGEEQPLGNIVSS
EPPAMPAFSANGEKGKAANYAGGMSLQEALKQNAAAGNIKIVAYPDTNSLLVKGTAEQVH
FIEMLVKALDVAKRHVELSLWIVDLNKSDLERLGTSWSGSITIGDKLGVSLNQSSISTLD
GSRFIAAVNALEEKKQATVVSRPVLLTQENVPAIFDNNRTFYTKLIGERNVALEHVTYGT
MIRVLPRFSADGQIEMSLDIEDGNDKTPQSDTTTSVDALPEVGRTLISTIARVPHGKSLL
VGGYTRDANTDTVQSIPFLGKLPLIGSLFRYSSKNKSNVVRVFMIEPKEIVDPLTPDASE
SVNNILKQSGAWSGDDKLQKWVRVYLDRGQEAIK