Protein Info for GFF4762 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 12 to 685 (674 residues), 956.6 bits, see alignment E=4e-292 PF00771: FHIPEP" amino acids 24 to 676 (653 residues), 712.3 bits, see alignment E=3.2e-218

Best Hits

Swiss-Prot: 100% identical to INVA_SALTY: Invasion protein InvA (invA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 100% identity to sea:SeAg_B3018)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (685 amino acids)

>GFF4762 Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VLLSLLNSARLRPELLILVLMVMIISMFVIPLPTYLVDFLIALNIVLAILVFMGSFYIDR
ILSFSTFPAVLLITTLFRLALSISTSRLILIEADAGEIIATFGQFVIGDSLAVGFVVFSI
VTVVQFIVITKGSERVAEVAARFSLDGMPGKQMSIDADLKAGIIDADAARERRSVLERES
QLYGSFDGAMKFIKGDAIAGIIIIFVNFIGGISVGMTRHGMDLSSALSTYTMLTIGDGLV
AQIPALLIAISAGFIVTRVNGDSDNMGRNIMTQLLNNPFVLVVTAILTISMGTLPGFPLP
VFVILSVVLSVLFYFKFREAKRSAAKPKTSKGEQPLSIEEKEGSSLGLIGDLDKVSTETV
PLILLVPKSRREDLEKAQLAERLRSQFFIDYGVRLPEVLLRDGEGLDDNSIVLLINEIRV
EQFTVYFDLMRVVNYSDEVVSFGINPTIHQQGSSQYFWVTHEEGEKLRELGYVLRNALDE
LYHCLAVTLARNVNEYFGIQETKHMLDQLEAKFPDLLKEVLRHATVQRISEVLQRLLSER
VSVRNMKLIMEALALWAPREKDVINLVEHIRGAMARYICHKFANGGELRAVMVSAEVEDV
IRKGIRQTSGSTFLSLDPEASANLMDLITLKLDDLLIAHKDLVLLTSVDVRRFIKKMIEG
RFPDLEVLSFGEIADSKSVNVIKTI