Protein Info for GFF4760 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion cytoplasmic ATP synthase (EC 3.6.3.14, YscN,SpaL,MxiB,HrcN,EscN)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR01026: ATPase, FliI/YscN family" amino acids 13 to 426 (414 residues), 431.5 bits, see alignment E=1.7e-133 PF02874: ATP-synt_ab_N" amino acids 15 to 80 (66 residues), 24.7 bits, see alignment E=4.2e-09 PF00006: ATP-synt_ab" amino acids 139 to 348 (210 residues), 274.7 bits, see alignment E=7.9e-86 PF18269: T3SS_ATPase_C" amino acids 355 to 425 (71 residues), 64.2 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 100% identical to SPAL_SALTI: Probable ATP synthase SpaL (spaL) from Salmonella typhi

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 100% identity to spt:SPA2752)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF4760 Type III secretion cytoplasmic ATP synthase (EC 3.6.3.14, YscN,SpaL,MxiB,HrcN,EscN) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTPRLLQYLAYPQKITGPIIEAELRDVAIGELCEIRRGWHQKQVVARAQVVGLQRERTV
LSLIGNAQGLSRDVVLYPTGRALSAWVGYSVLGAVLDPTGKIVERFTPEVAPISEERVID
VAPPSYASRVGVREPLITGVRAIDGLLTCGVGQRMGIFASAGCGKTMLMHMLIEQTEADV
FVIGLIGERGREVTEFVDMLRASHKKEKCVLVFATSDFPSVDRCNAAQLATTVAEYFRDQ
GKRVVLFIDSMTRYARALRDVALASGERPARRGYPASVFDNLPRLLERPGATSEGSITAF
YTVLLESEEEADPMADEIRSILDGHLYLSRKLAGQGHYPAIDVLKSVSRVFGQVTTPTHA
EQASAVRKLMTRLEELQLFIDLGEYRPGENIDNDRAMQMRDSLKAWLCQPVAQYSSFDDT
LSGMNAFADQN